PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G37310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 146aa    MW: 16544.8 Da    PI: 9.6812
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G37310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.78.2e-1664116355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  OPUNC01G37310.1  64 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAKMFKEQEEQHQK 116
                      689*************************************9998777654443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-862126IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.57664128IPR004827Basic-leucine zipper domain
PfamPF001703.5E-1564123IPR004827Basic-leucine zipper domain
CDDcd147076.45E-1766116No hitNo description
SuperFamilySSF579594.38E-1166116No hitNo description
Gene3DG3DSA:1.20.5.1703.9E-1467124No hitNo description
PROSITE patternPS0003606984IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MTLEDFLARE GAVKEDEAVV TDPSASVAEG QVVMGFLNGA DGAGGATGGR SRKRHLLDPM  60
DRAAMQRQKR MIKNRESAAR SRERKQAYIA ELESLVTQLE EENAKMFKEQ EEQHQKRLKE  120
LKEMVGPVII RKTSARDLRR TNSMEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679190.0AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
GenBankGQ9042380.0GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
GenBankOSU252830.0U25283.1 Oryza sativa clone OSE2 leucine zipper protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.12e-92PREDICTED: G-box-binding factor 4
SwissprotP427773e-31GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A0E0JRH91e-103A0A0E0JRH9_ORYPU; Uncharacterized protein
STRINGLOC_Os01g64730.16e-92(Oryza sativa Japonica Group)
STRINGORGLA01G0323500.16e-92(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-28bZIP family protein